Cat: PA2000-2022

Recombinant Human HCRTR1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HCRTR1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HCRTR1;Orexin/Hypocretin receptor type 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43613

  • Expression Region

    1-46aa

  • AA Sequence

    MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE

  • Molecular Weight

    21.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HCRTR1, or hypocretin receptor 1, is a G-protein-coupled receptor primarily involved in the regulation of arousal, wakefulness, and appetite, interacting with endogenous neuropeptides called hypocretins (or orexins). The discovery of hypocretins has provided significant insights into sleep disorders, particularly narcolepsy, a condition characterized by excessive daytime sleepiness and sudden sleep attacks. Genetic studies have shown that the loss of hypocretin-producing neurons in the hypothalamus contributes to narcolepsy, making HCRTR1 a promising target for therapeutic intervention. Researchers have focused on the structure-function relationship of HCRTR1 to better understand its role in neurotransmission and potential pathways for drug development. Recombinant HCRTR1 protein production allows for advanced studies on receptor binding, signaling mechanisms, and the pharmacology of potential agonists or antagonists. By utilizing techniques such as crystallography and ligand binding assays, scientists aim to elucidate the receptor's behavior in vitro, paving the way for novel treatments for sleep-related disorders and offering broader insights into the neurobiology of wakefulness and energy balance. This research is critical not only for addressing specific ailments like narcolepsy but also for understanding the complex interplay between sleep regulation and metabolic processes, highlighting the receptor's importance in both neurobiology and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US