Analytical Data
-
Gene name
MYEF2
- Application
-
Alternative Names
MYEF2;KIAA1341;Myelin expression factor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P2K5
-
Expression Region
372-576aa
-
AA Sequence
GGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINQGFGDSFGRLGSAMIGGFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAE
-
Molecular Weight
37.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYEF2, also known as Myocyte Enhancer Factor 2D, is a critical transcription factor that plays a significant role in muscle development, differentiation, and regeneration. Recent studies have highlighted its importance in various physiological processes, including neuronal functions and cardiac muscle responses to stress. The focus on MYEF2 recombinant protein has emerged due to its potential applications in understanding muscle disorders and developing regenerative therapies. Researchers are investigating the molecular mechanisms by which MYEF2 regulates gene expression and protein interactions, as alterations in its function are associated with diseases such as muscular dystrophies and heart failure. The recombinant MYEF2 protein allows for the manipulation of MYEF2 activity in laboratory settings, facilitating the elucidation of its pathways and interactions. Moreover, this research holds promise for therapeutic advancements, as harnessing the regulatory capabilities of MYEF2 could lead to innovative treatments for muscle and cardiac disorders. As a result, the recombinant expression and functional study of MYEF2 is not only pivotal for basic biological research but also for translational medicine aimed at improving regenerative strategies and understanding disease mechanisms.











