Cat: IPD-X12817

Recombinant Human Angiopoietin-4 Protein(HEK293), N-hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Angiopoietin-4

  • 简介

    Angiopoietin 4 protein (ANGPT4) critically binds to TEK/TIE2, regulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation. In addition to regulation, ANGPT4 promotes endothelial cell survival, migration, and angiogenesis. Angiopoietin-4 Protein, Human (HEK293, Fc) is the recombinant human-derived Angiopoietin-4 protein, expressed by HEK293 , with N-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to compete with biotinylated rhAng-2 for binding to immobilized Tie-2 in a functional ELISA. When Recombinant Human Tie-2 Protein (HY-P72450) is immobilized at 5 µg/mL (100 µL/well), Recombinant Human Angiopoietin-4 binds with an ED50 of 0.1030 μg/mL, in the presence of 5 µg/mL biotinylated rhAng-2 (HY-P72828). Measured by its ability to compete with biotinylated rhAng-2 for binding to immobilized Tie-2 in a functional ELISA. When Recombinant Human Tie-2 Protein (HY-P72450) is immobilized at 5 µg/mL (100 µL/well), Recombinant Human Angiopoietin-4 binds with an ED50 of 0.1030 μg/mL, in the presence of 5 µg/mL biotinylated rhAng-2 (HY-P72828).

  • Alternative Names

    Angiopoietin-4; AGP4; ANG-3; ANG-4; ANGPT4

  • Species

    Human

  • Source

    HEK293

  • Tag

    N-hFc

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    Q9Y264-1

  • Expression Region

    M282-I503

  • AA Sequence

    MAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI

  • Protein Length

    Partial

  • Molecular Weight

    58-77 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Angiopoietin-4 (Ang-4) is a member of the angiopoietin family of proteins, which play crucial roles in vascular development and function. It is primarily involved in the regulation of angiogenesis, the formation of new blood vessels from pre-existing ones, which is critical in various physiological and pathological processes, including wound healing, inflammation, and cancer progression. Unlike other angiopoietins, Ang-4 exhibits unique properties that allow it to function both as an angiogenic factor and a modulator of vascular permeability. Recent studies have identified Ang-4's potential role in promoting tumor metastasis and influencing immune responses, making it a target of interest in cancer research and therapeutic applications. Recombinant Ang-4 proteins are being developed for various experimental and clinical uses, such as studying its mechanisms in cell signaling, evaluating its effects on endothelial cell behavior, and exploring its therapeutic potential in diseases characterized by aberrant angiogenesis. Understanding the function and regulation of Ang-4 can provide insights into novel treatment strategies for cancer and other angiogenesis-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US