Analytical Data
-
Gene name
C14orf68
- Application
-
Alternative Names
Solute carrier family 25 member 47. Hepatocellular carcinoma down-regulated mitochondrial carrier Protein. Mitochondrial NAD(+) transporter SLC25A47
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6Q0C1
-
Expression Region
1-308aa
-
AA Sequence
MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEPKYTGIWHCVRDTYHRERVWGFYRGLSLPVCTVSLVSSVSFGTYRHCLAHICRLRYGNPDAKPTKADITLSGCASGLVRVFLTSPTEVAKVRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYKGSSALVLRDGHSFATYFLSYAVLCEWLSPAGHSRPDVPGVLVAGGCAGVLAWAVATPMDVIKSRLQADGQGQRRYRGLLHCMVTSVREEGPRVLFKGLVLNCCRAFPVNMVVFVAYEAVLRLARGLLT
-
Molecular Weight
59.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf68, also known as "Chromosome 14 Open Reading Frame 68," has garnered increasing attention in the scientific community due to its potential roles in various cellular processes and diseases. Initially identified through genomic studies, C14orf68 is located on chromosome 14 and is believed to be involved in the regulation of gene expression and cellular signaling pathways. Recent research has suggested that C14orf68 may be linked to developmental disorders and certain types of cancer, making it a candidate for further investigation in biomedical research. The exploration of C14orf68 recombinant protein aims to elucidate its functional properties and interactions within cellular systems. By producing this protein in vitro, researchers can study its biochemical characteristics, analyze its role in various molecular pathways, and assess its potential as a therapeutic target. Additionally, understanding the structure and function of the C14orf68 protein may provide insights into the mechanisms underlying its association with specific diseases. Overall, the study of C14orf68 recombinant protein represents a promising frontier in the field of molecular biology and holds the potential for significant contributions to our understanding of gene regulation and disease pathology.
