Analytical Data
-
Gene name
C16orf57
- Application
-
Alternative Names
U6 snRNA phosphodiesterase 1. hUsb1. 3'-5' RNA exonuclease USB1. EC:4.6.1.-. Mutated in poikiloderma with neutropenia Protein 1. Mutated in PN Protein 1. hMpn1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQ65
-
Expression Region
1-265aa
-
AA Sequence
MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK
-
Molecular Weight
56.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C16orf57, also known as P3H2, is a gene located on chromosome 16 that encodes a protein belonging to the peptidyl-prolyl isomerase family. This protein is implicated in various cellular processes, including the folding and maturation of collagen and other extracellular matrix proteins. Recent studies have indicated that C16orf57 plays a crucial role in maintaining cellular homeostasis, particularly in the context of stress responses and developmental processes. Abnormal expression or mutations in C16orf57 have been linked to several pathological conditions, including genetic disorders and cancer. Researchers are particularly interested in C16orf57 due to its potential as a therapeutic target and biomarker for disease. The recombinant expression of C16orf57 protein has been established to facilitate the investigation of its functional properties, interactions with other proteins, and its role in collagen biosynthesis. Employing techniques such as molecular cloning, protein purification, and functional assays, researchers aim to elucidate the precise mechanisms through which C16orf57 influences cellular function and its implications in disease. Understanding the biology of C16orf57 through recombinant protein studies is not only vital for uncovering its physiological roles but also for developing targeted interventions to modulate its activity in various disease contexts. Thus, the ongoing research on C16orf57 represents a significant effort in the fields of molecular biology and biomedical research, with the potential to contribute to innovative therapeutic strategies.
