Analytical Data
-
Gene name
C16orf78
- Application
-
Alternative Names
C16orf78; Uncharacterized Protein C16orf78
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WTQ4
-
Expression Region
1-265aa
-
AA Sequence
MSEQQMDLKDLMPTKRKYMWKTAEDRRMSDLTCVLEWLERRQGKKKQAPEKQKPKVVTVLKRNKKKEEKKGKGLMTARGGNRRDTETSQQALGKRFRKDAASYRSLYGVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVLDPMLQEGTFNSQRATFIRDWSNKMPDMAYERKLKSLMEKSTEPKMETMRMLKPEEVLSCRYLRLSKENIRTLLKLCKDAGMNVDIHPHMVEEDIDAKKVFTGIPSMAL
-
Molecular Weight
57.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C16orf78, a gene located on chromosome 16, has garnered significant attention in recent years due to its potential roles in various cellular processes and diseases. Initially identified through genomic studies, C16orf78 encodes a protein whose exact functions remain largely ambiguous. Emerging evidence suggests that C16orf78 may be implicated in critical biological pathways, including cell proliferation, apoptosis, and DNA repair, thereby positioning it as a candidate for further exploration in the context of cancer research and other metabolic disorders. Notably, its expression levels have been correlated with tumorigenesis in certain cancer types, indicating that the protein might serve as a biomarker for disease progression or therapeutic response. Researchers have begun to create recombinant forms of C16orf78 to study its biochemical properties and interactions within cellular systems. The generation of these recombinant proteins has enabled the investigation of their functional roles in detail, opening new avenues for understanding how C16orf78 contributes to pathophysiological conditions. Additionally, due to the lack of extensive prior research, the study of C16orf78 offers a unique opportunity to uncover novel molecular mechanisms critical for cell function and disease. As such, the ongoing research into C16orf78, utilizing advanced techniques in molecular biology and biochemistry, aims to elucidate its potential as a therapeutic target, ultimately contributing to the development of innovative strategies for cancer treatment and other related diseases.











