Cat: PA2000-6026

Recombinant Human C16orf78 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C16orf78

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C16orf78; Uncharacterized Protein C16orf78

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WTQ4

  • Expression Region

    1-265aa

  • AA Sequence

    MSEQQMDLKDLMPTKRKYMWKTAEDRRMSDLTCVLEWLERRQGKKKQAPEKQKPKVVTVLKRNKKKEEKKGKGLMTARGGNRRDTETSQQALGKRFRKDAASYRSLYGVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVLDPMLQEGTFNSQRATFIRDWSNKMPDMAYERKLKSLMEKSTEPKMETMRMLKPEEVLSCRYLRLSKENIRTLLKLCKDAGMNVDIHPHMVEEDIDAKKVFTGIPSMAL

  • Molecular Weight

    57.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C16orf78, a gene located on chromosome 16, has garnered significant attention in recent years due to its potential roles in various cellular processes and diseases. Initially identified through genomic studies, C16orf78 encodes a protein whose exact functions remain largely ambiguous. Emerging evidence suggests that C16orf78 may be implicated in critical biological pathways, including cell proliferation, apoptosis, and DNA repair, thereby positioning it as a candidate for further exploration in the context of cancer research and other metabolic disorders. Notably, its expression levels have been correlated with tumorigenesis in certain cancer types, indicating that the protein might serve as a biomarker for disease progression or therapeutic response. Researchers have begun to create recombinant forms of C16orf78 to study its biochemical properties and interactions within cellular systems. The generation of these recombinant proteins has enabled the investigation of their functional roles in detail, opening new avenues for understanding how C16orf78 contributes to pathophysiological conditions. Additionally, due to the lack of extensive prior research, the study of C16orf78 offers a unique opportunity to uncover novel molecular mechanisms critical for cell function and disease. As such, the ongoing research into C16orf78, utilizing advanced techniques in molecular biology and biochemistry, aims to elucidate its potential as a therapeutic target, ultimately contributing to the development of innovative strategies for cancer treatment and other related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US