Analytical Data
-
Gene name
SNPH
- Application
-
Alternative Names
SNPH;KIAA0374;Syntaphilin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15079
-
Expression Region
1-424aa
-
AA Sequence
MAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRH
-
Molecular Weight
62.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SNPH (Synphilin-1) is a protein implicated in neurological disorders, particularly in the context of Parkinson's disease. As a component of the cellular machinery involved in protein aggregation, SNPH has been shown to interact with alpha-synuclein, a key protein in the formation of Lewy bodies, which are pathological hallmarks of Parkinson's. Research has revealed that the aggregation of alpha-synuclein and the subsequent formation of toxic oligomers contribute to neuronal degeneration. Understanding SNPH's role in this process is crucial for elucidating the mechanisms underlying Parkinson's disease and for identifying potential therapeutic targets. Recent studies have focused on the structural properties and aggregation behavior of SNPH when expressed as a recombinant protein. Investigating SNPH's interactions with both alpha-synuclein and other cellular factors may uncover its dual role in promoting aggregation and protecting against neurodegeneration. Furthermore, recombinant expression systems aid in producing functional SNPH for biochemical assays, allowing researchers to examine its effects on cellular models of disease. Ultimately, these studies aim to provide insights into the molecular pathways involved in synucleinopathies and to inform the development of innovative strategies for intervention.











