Analytical Data
-
Gene name
C20orf117
- Application
-
Alternative Names
C20orf117; CT117_HUMAN; dJ132F21.1; FLJ44670; hypothetical Protein LOC140710; KIAA0889; Protein SOGA1; SOGA; SOGA family member 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O94964
-
Expression Region
1-518aa
-
AA Sequence
MWDWAPTTSLQEVNKTVLVFALTQHTDQGGRPECALSVISTNNDVSSSVLRRTKSVSSMSEFESLLDCSPYLAGGDARGKKLPNNPAFGFVSSEPGDPEKDTKEKPGLSSRDCNHLGALACQDPPGRQMQRSYTAPDKTGIRVYYSPPVARRLGVPVVHDKEGKIIIEPGFLFTTAKPKESAEADGLAESSYGRWLCNFSRQRLDGGSAGSPSAAGPGFPAALHDFEMSGNMSDDMKEITNCVRQAMRSGSLERKVKSTSSQTVGLASVGTQTIRTVSVGLQTDPPRSSLHGKAWSPRSSSLVSVRSKQISSSLDKVHSRIERPCCSPKYGSPKLQRRSVSKLDSSKDRSLWNLHQGKQNGSAWARSTTTRDSPVLRNINDGLSSLFSVVEHSGSTESVWKLGMSETRAKPEPPKYGIVQEFFRNVCGRAPSPTSSAGEEGTKKPEPLSPASYHQPEGVARILNKKAAKLGSSEEVRLTMLPQVGKDGVLRDGDGAVVLPNEVGGWDLSFLLVGGVSI
-
Molecular Weight
82.2 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf117, also known as the cancer-testis antigen, has garnered significant attention in recent years due to its potential role in tumor biology and immunotherapy. Located on chromosome 20, this gene encodes a protein that is typically expressed in testicular germ cells and various malignancies, making it a candidate for cancer immunotherapy targeting. Research has indicated that C20orf117 may contribute to the proliferation and migration of cancer cells, providing insights into its role in tumorigenesis and metastasis. Moreover, its restricted expression pattern suggests that targeting this antigen could elicit a robust immune response with minimal effects on normal tissues, underscoring its promise as an immunotherapeutic target. Previous studies have utilized recombinant protein techniques to investigate the immunogenicity of C20orf117, revealing the potential for it to serve as a biomarker for certain cancers. Understanding the molecular mechanisms governing C20orf117 expression and function in cancer could pave the way for novel therapeutic strategies and improve the specificity and efficacy of existing treatments. The ongoing research aims to develop C20orf117-based vaccines or adoptive T-cell therapies, which could enhance the body's immune response against tumors expressing this antigen. As a result, the study of C20orf117 not only expands our understanding of cancer biology but also highlights its potential as a valuable target in the quest for more effective cancer therapies.
