Analytical Data
-
Gene name
RAP2C
- Application
-
Alternative Names
RAP2C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3L5
-
Expression Region
1-180 aa
-
AA Sequence
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTC
-
Molecular Weight
27.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAP2C is a member of the RAB family of small GTPases, which play pivotal roles in intracellular membrane trafficking, signal transduction, and cellular proliferation. As a key regulator in various cellular processes, RAP2C has been implicated in the modulation of cell growth, differentiation, and response to external stimuli. Research into RAP2C has gained momentum due to its potential links to several human diseases, including cancer, wherein altered expression and function of RAP2C may influence tumor progression and metastasis. Moreover, RAP2C has been shown to interact with numerous effector proteins, suggesting its involvement in a wide array of signaling pathways. By generating recombinant RAP2C proteins, researchers aim to elucidate its biochemical properties, regulatory mechanisms, and interaction networks, which could provide insights into its functional roles in health and disease. The study of RAP2C not only enhances our understanding of the underlying molecular mechanisms but also opens new avenues for targeted therapeutic strategies that could modulate its activity in pathological conditions.
