Analytical Data
-
Gene name
gltX1
- Application
-
Alternative Names
gltX1；gltX1；Glutamyl-tRNA reductase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P96551
-
Expression Region
1-463aa
-
AA Sequence
MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMGYLKEALVNFLARLGWSYQDKEVFSMQELLELFDPKDLNSSPSCFSWHKLNWLNAHYLKNQSVQELLKLLKPFSFSDLSHLNPTQLDRLLDALKERSQTLKELALKIDEVLIAPVEYEEKVFKKLNQALVMPLLEKFKLELNKANFNDESALENAMRQIIEEEKIKAGSFMQPLRLALLGKGGGIGLKEALFILGKTESVKRIEDFLKN
-
Molecular Weight
55.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the gltX1 recombinant protein has garnered significant attention due to its potential role in understanding various biological processes and its implications in biotechnology and medicine. GltX1, encoded by the gltX1 gene, is associated with nutrient transport and cellular metabolism in various microorganisms, notably within pathogenic species. Investigations into its structural and functional properties have revealed that gltX1 may be vital for the survival and virulence of these organisms, making it an attractive target for drug development and therapeutic interventions. Moreover, the recombinant expression of GltX1 provides a valuable tool for elucidating its biochemical properties and interaction mechanisms. Advances in recombinant DNA technology now allow for its production in heterologous systems, facilitating detailed studies on its activity and potential applications. Understanding the structure-function relationship of GltX1 can lead to insights into how pathogens adapt to host environments and might open avenues for novel antimicrobial strategies. Furthermore, as the global health landscape evolves, focusing on such proteins is crucial for addressing antibiotic resistance and developing innovative treatments. Thus, the research surrounding gltX1 not only contributes to fundamental microbiology but also aligns with pressing medical challenges in combatting infectious diseases.
