Analytical Data
-
Gene name
C20orf18
- Application
-
Alternative Names
C20orf18; Chromosome 20 open reading frame 18; HBV associated factor 4 ; HBV-associated factor 4; Heme-oxidized IRP2 ubiquitin ligase 1; Hepatitis B virus X associated Protein 4; Hepatitis B virus X-associated Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYM8
-
Expression Region
1-230aa
-
AA Sequence
MGTATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQGVPAGHHPQQPGGGGLLPLH
-
Molecular Weight
52.1 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf18, also known as "Chromosome 20 Open Reading Frame 18," has garnered increasing attention in the field of molecular biology and genetics due to its potential role in various cellular processes and diseases. Recent studies suggest that C20orf18 may be involved in essential cellular functions such as cell proliferation, differentiation, and apoptosis, indicating its possible significance in development and disease mechanisms. Additionally, aberrations in the expression of C20orf18 have been linked to certain types of cancer, highlighting its relevance in oncological research. The recombinant protein of C20orf18 serves as a crucial tool for elucidating its biological functions and pathways. By producing this protein in a recombinant system, researchers can study its interactions with other cellular components, assess its enzymatic activities, and evaluate its effects on cellular signaling networks. Furthermore, understanding the structure-function relationship of C20orf18 at a molecular level may provide insights into its role in health and disease, paving the way for potential therapeutic strategies. Overall, the study of C20orf18 recombinant protein holds promise for advancing our understanding of its biological significance and its contributions to the pathophysiology of various disorders.
