Analytical Data
-
Gene name
PMP2
- Application
-
Alternative Names
PMP2;Myelin P2 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02689
-
Expression Region
1-132aa
-
AA Sequence
MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
-
Molecular Weight
41.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PMP2 (Plant MAP Kinase Phosphatase 2) is a pivotal protein in plant stress responses and signaling pathways, particularly in the regulation of MAPK (Mitogen-Activated Protein Kinase) cascades. MAPKs play a critical role in mediating various physiological processes, including growth, development, and responses to environmental stresses such as drought, salinity, and pathogen attacks. PMP2, as a phosphatase, deactivates MAPKs, thereby modulating their activity and ensuring a balanced response to stress. The study of PMP2 and its role in the MAPK signaling pathway is significant for understanding how plants adapt to adverse conditions. Furthermore, given the increasing challenges posed by climate change and the necessity for sustainable agriculture, enhancing plant resilience through the manipulation of proteins like PMP2 could lead to the development of crops with improved stress tolerance. Recent advances in molecular biology and genetic engineering techniques have facilitated the exploration of PMP2’s functional mechanisms, offering insights into its potential applications in biotechnological innovations aimed at crop improvement. Understanding PMP2's intricate role could pave the way for novel strategies to boost plant robustness, ultimately contributing to food security in a changing environment.











