Cat: PA2000-2421

Recombinant Human PMP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PMP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PMP2;Myelin P2 Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P02689

  • Expression Region

    1-132aa

  • AA Sequence

    MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

  • Molecular Weight

    41.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PMP2 (Plant MAP Kinase Phosphatase 2) is a pivotal protein in plant stress responses and signaling pathways, particularly in the regulation of MAPK (Mitogen-Activated Protein Kinase) cascades. MAPKs play a critical role in mediating various physiological processes, including growth, development, and responses to environmental stresses such as drought, salinity, and pathogen attacks. PMP2, as a phosphatase, deactivates MAPKs, thereby modulating their activity and ensuring a balanced response to stress. The study of PMP2 and its role in the MAPK signaling pathway is significant for understanding how plants adapt to adverse conditions. Furthermore, given the increasing challenges posed by climate change and the necessity for sustainable agriculture, enhancing plant resilience through the manipulation of proteins like PMP2 could lead to the development of crops with improved stress tolerance. Recent advances in molecular biology and genetic engineering techniques have facilitated the exploration of PMP2’s functional mechanisms, offering insights into its potential applications in biotechnological innovations aimed at crop improvement. Understanding PMP2's intricate role could pave the way for novel strategies to boost plant robustness, ultimately contributing to food security in a changing environment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US