Analytical Data
-
Gene name
iagB
- Application
-
Alternative Names
iagB；Invasion Protein IagB
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0CL15
-
Expression Region
20-160aa
-
AA Sequence
DCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK
-
Molecular Weight
32.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the iagB recombinant protein is rooted in its significant role in bacterial infections and pathogenesis. iagB, or "invasion-associated gene B," is primarily found in various pathogenic strains of bacteria, particularly in Escherichia coli. This gene is crucial for the bacterium's ability to invade host cells and evade the immune response, making it a potential target for therapeutic interventions. Research into iagB has gained momentum due to the increasing prevalence of antibiotic-resistant bacterial strains, which has underscored the need for novel antimicrobial strategies. By understanding the molecular mechanisms underlying iagB function, scientists aim to elucidate how it contributes to virulence and bacterial survival within host environments. Furthermore, the recombinant expression of iagB allows for detailed studies of its structural and functional properties, which can aid in the development of vaccines or inhibitors. As such, the exploration of iagB not only enhances our understanding of bacterial behavior but also holds promise for advancing public health by offering new avenues for combating infectious diseases.
