Analytical Data
-
Gene name
Reg1
- Application
-
Alternative Names
Reg1；PSPS2；REGL；Lithostathine-1-beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05451
-
Expression Region
23-166aa
-
AA Sequence
QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNL VSVLTQAEGA FVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSV NPGYCVSLTS STGFQKWKDVPCEDKFSFVCKFKNVDHHHHHH
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Reg1 protein, also known as regenerating protein 1, belongs to a family of proteins typically involved in cellular response to stress and tissue regeneration. Originally identified in the pancreatic tissue of regenerating or injured organs, Reg1 is known for its role in promoting cellular growth and division, making it a subject of interest in regenerative medicine and oncology. Studies have indicated that Reg1 is upregulated in various pathological conditions, such as diabetes and cancer, suggesting its potential as a biomarker for disease progression. Researchers have focused on understanding the molecular mechanisms underlying Reg1 function, including its effects on cellular signaling pathways and interactions with other proteins. Additionally, Reg1's involvement in immune responses points to its significance in inflammatory diseases. Given the rising interest in therapeutic applications, such as engineered Reg1 recombinant proteins, ongoing investigations aim to elucidate its structural properties and biological activities to harness its regenerative potential in clinical settings. Overall, Reg1 stands as a promising candidate for further exploration in the quest for innovative treatments for various diseases.
