Cat: PA2000-2813

Recombinant E.coli hupA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    hupA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    hupA;DNA-binding Protein HU-alpha

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0ACF1

  • Expression Region

    1-90aa

  • AA Sequence

    MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK

  • Molecular Weight

    11.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HupA is a protein that plays a critical role in the physiological processes of various microorganisms, particularly in the context of environmental adaptability and stress response. It serves as a subunit of the DNA-dependent RNA polymerase in certain bacteria, influencing gene expression and regulation. The study of HupA recombinant proteins has gained prominence due to their potential applications in biotechnology and medicine. By understanding the molecular structure and function of HupA, researchers aim to explore its role in microbial metabolism, biofilm formation, and pathogenesis. The recombinant expression of HupA allows scientists to produce large quantities of this protein, facilitating detailed biochemical assays and structural analyses. These studies not only shed light on the fundamental biological mechanisms governing microbial life but also open avenues for developing novel antimicrobial strategies and biotechnological applications. Furthermore, the ability to manipulate HupA through genetic engineering offers exciting prospects for enhancing microbial strains with desirable traits, contributing to advancements in bioengineering and synthetic biology. Overall, the research on HupA recombinant proteins is a significant area of investigation that bridges microbiology, molecular biology, and applied sciences, highlighting the importance of understanding microbial adaptations in various ecological and industrial contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US