Cat: PA2000-2855

Recombinant Human UL83 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UL83

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UL83;C6orf150;MB21D1;Cyclic GMP-AMP synthase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06725

  • Expression Region

    351-480aa

  • AA Sequence

    FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA

  • Molecular Weight

    18.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UL83 protein, also known as pp65, is a prominent immediate-early gene product of human cytomegalovirus (HCMV), which is a member of the Herpesviridae family. This protein plays a crucial role in the viral lifecycle, influencing both viral replication and immune evasion. Research into UL83 has garnered significant attention due to its potential as a target for therapeutic interventions and vaccine development against HCMV, a virus that can cause severe complications in immunocompromised individuals and congenital infections in newborns. Studies have shown that UL83 can modulate host immune responses by inhibiting antigen presentation and promoting immune tolerance. Furthermore, the protein can also be utilized as a biomarker for HCMV infection and disease progression. As such, understanding the structure and function of UL83 is pivotal for developing strategies to combat HCMV-related diseases. Recent advances in molecular biology, including genetic engineering and structural biology techniques, have paved the way for in-depth investigations into UL83, enabling researchers to explore its interactions with host cellular machinery and its role in viral pathogenesis. The insights gained from these studies could lead to novel therapeutic approaches that enhance the immune response against HCMV and ultimately improve patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US