Analytical Data
-
Gene name
VACWR088
- Application
-
Alternative Names
VACWR088；Entry-fusion complex associated Protein OPG095
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07612
-
Expression Region
1-250aa
-
AA Sequence
MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPMVIATTDMQN
-
Molecular Weight
27.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VACWR088 is a recombinant protein derived from the Vaccinia virus, a member of the Poxviridae family, which has garnered significant interest due to its potential applications in therapeutic and vaccinological research. The understanding of VACWR088 is rooted in the broader context of viral immunology and the mechanisms of immune evasion. As poxviruses possess a unique ability to modulate host immune responses, research on their proteins, including VACWR088, aims to elucidate their roles in immune regulation, potentially offering insights into viral pathogenicity and persistence. Notably, VACWR088 has been implicated in influencing the activation of immune cells and could serve as a target for novel vaccine development strategies. The recombinant expression of this protein enables detailed studies of its function and interactions within the immune system, paving the way for innovative approaches to enhance vaccine efficacy and design. Overall, the exploration of VACWR088 not only contributes to our understanding of poxvirus biology but also demonstrates the potential for leveraging viral components in immunotherapy and vaccine design against various infectious diseases.
