Analytical Data
-
Gene name
MPK5
- Application
-
Alternative Names
MPK5;MEK5;MKK5;PRKMK5;Dual specificity mitogen-activated Protein kinase kinase 5
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q10N20
-
Expression Region
1-369aa
-
AA Sequence
MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAFNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPPIPQAFNDVYIATELMDTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPLFPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAALDLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLIFNEAIEMNPNIRY
-
Molecular Weight
48.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MPK5 (Mitogen-Activated Protein Kinase 5) is a member of the MAPK family, which plays a pivotal role in various cellular processes, including growth, differentiation, and responses to environmental stimuli. In the context of plant biology, MPK5 has garnered attention due to its involvement in stress responses, particularly in plants' reactions to biotic and abiotic stressors. Research has revealed that MPK5 acts as a critical component in signaling pathways that regulate plant immunity and developmental processes. Its ability to phosphorylate target proteins allows it to modulate various downstream effects, influencing plant resilience against pathogens and adverse environmental conditions. Recent studies have focused on the recombinant production of MPK5 to better understand its functional mechanisms and interactions with other proteins in signaling cascades. By producing MPK5 as a recombinant protein, researchers can conduct biochemical analyses and structural studies, leading to insights into its role in plant defense mechanisms. This research lays the groundwork for potential applications in agriculture, where enhancing the expression or activity of MPK5 could lead to the development of crops with improved stress tolerance and disease resistance. Understanding MPK5's role in plant signaling networks represents a significant step forward in the field of plant molecular biology, with implications for improving crop resilience in the face of climate change and increasing agricultural demands.











