Analytical Data
-
Gene name
ST3GAL3
- Application
-
Alternative Names
ST3GAL3；SIAT6；CMP-N-acetylneuraminate-beta-1.4-galactoside alpha-2.3-sialyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q11203
-
Expression Region
29-375aa
-
AA Sequence
KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
-
Molecular Weight
54.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ST3GAL3, or ST3 beta-galactoside alpha-2,3-sialyltransferase 3, is an enzyme that plays a crucial role in the biosynthesis of sialylated glycoconjugates, which are important for various biological processes, including cell-cell interactions, immune response, and pathogen recognition. The enzyme catalyzes the transfer of sialic acid to glycoproteins and glycolipids, thereby influencing cellular signaling and adhesion. Dysregulation of sialylation, including ST3GAL3 activity, has been implicated in various diseases, such as cancer, where altered sialylation patterns can contribute to tumor progression and metastasis. As a result, there is growing interest in the potential use of ST3GAL3 as a therapeutic target and biomarker. Researchers are investigating the mechanisms by which ST3GAL3 mediates these processes and exploring recombinant protein production to facilitate structure-function studies, enzyme activity assays, and potential inhibitor screening. Understanding the role of ST3GAL3 in sialic acid metabolism may lead to novel strategies for disease intervention, highlighting its significance in glycoscience and medicinal research.
