Cat: PAX2000-11144

Recombinant Human SCAP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SCAP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    pp55; SCAP 1; SCAP1; SKAP 1; SKAP 55; SKAP-55; Skap1; SKAP1_HUMAN; SKAP55 adaptor protein; SRC family associated phosphoprotein 1; Src family-associated phosphoprotein 1; Src kinase associated phosphoprotein 1; SRC kinase associated phosphoprotein 55 kD; Src kinase associated phosphoprotein of 55 kDa; Src kinase-associated phosphoprotein 1; Src kinase-associated phosphoprotein of 55 kDa

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86WV1

  • Expression Region

    1-358 aa

  • AA Sequence

    MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEE

  • Molecular Weight

    57.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SCAP1 (SREBP Cleavage-Activating Protein 1) is a crucial protein involved in the regulation of lipid metabolism and cholesterol homeostasis. It facilitates the activation of Sterol Regulatory Element-Binding Proteins (SREBPs), which are key transcription factors that regulate the expression of genes involved in lipid synthesis and uptake. Research on SCAP1 has gained attention due to its potential role in metabolic disorders, including obesity, type 2 diabetes, and cardiovascular diseases. Understanding SCAP1's structure and function can provide insights into its mechanistic role in lipid metabolism, and how it contributes to the pathogenesis of these diseases. Recent studies have focused on SCAP1’s interactions with other cellular proteins and its regulatory mechanisms under different physiological conditions, aiming to identify potential therapeutic targets for metabolic diseases. Moreover, the recombinant production of SCAP1 has enabled researchers to study its biochemical properties and interaction dynamics in vitro, paving the way for the development of drugs that can modulate its activity. Overall, the investigation of SCAP1 serves as a vital avenue for uncovering the complexities of lipid regulation and its implications for human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US