Analytical Data
-
Gene name
SCAP2
- Application
-
Alternative Names
Src kinase-associated phosphoprotein 2. Pyk2/RAFTK-associated protein. Retinoic acid-induced protein 70. SKAP55 homolog. SKAP-55HOM. SKAP-HOM. Src family-associated phosphoprotein 2. Src kinase-associated phosphoprotein 55-related protein. Src-associated adapter protein with PH and SH3 domains
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75563
-
Expression Region
1-359 aa
-
AA Sequence
MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
-
Molecular Weight
65.23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCAP2 (SREBP cleavage-activating protein 2) is a crucial component of the sterol regulatory element-binding protein (SREBP) pathway, which plays an essential role in lipid metabolism and cellular cholesterol homeostasis. Recent studies have highlighted the importance of SCAP2 in regulating the activation of SREBP, a transcription factor that modulates the expression of various genes involved in cholesterol and fatty acid synthesis. Abnormal functioning of the SREBP pathway is associated with metabolic disorders such as obesity, insulin resistance, and cardiovascular diseases. As SCAP2 is fundamental in bridging the cellular lipid sensing with gene regulation, the characterization of SCAP2 recombinant protein has become an important focus in biochemical research. By producing SCAP2 as a recombinant protein, researchers aim to study its structure, function, and interactions with other cellular components in detail. This research could facilitate the identification of therapeutic targets and the development of novel strategies to combat metabolic diseases. Understanding the mechanistic role of SCAP2 in the SREBP pathway may provide insights into potential interventions that could restore normal lipid metabolism and prevent the progression of associated disorders. As such, SCAP2 serves as a promising avenue for advancements in biomedical research and the development of innovative treatments for metabolic syndromes.
