Analytical Data
-
Gene name
CKLFSF4
- Application
-
Alternative Names
CKLF-like MARVEL transmembrane domain-containing protein 4. Chemokine-like factor superfamily member 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IZR5
-
Expression Region
1-234aa
-
AA Sequence
MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVLAALNHRAGAEIAAVIFGFLATAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA
-
Molecular Weight
52.2 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CKLFSF4 (Cytokine-like factor 4) is a protein that has garnered significant attention in recent years due to its potential role in various biological processes and diseases. Emerging research suggests that CKLFSF4 may be involved in modulating immune responses, influencing inflammation, and regulating certain cellular functions. Given its structural similarities to other cytokine-like proteins, understanding the mechanisms by which CKLFSF4 operates could provide insights into its function in health and disease. The exploration of CKLFSF4 as a recombinant protein enables researchers to investigate its biochemical properties, interactions with other proteins, and potential therapeutic applications. Early studies have indicated that CKLFSF4 may play a role in disorders such as autoimmune diseases and cancer, highlighting its potential as a biomarker or therapeutic target. Furthermore, advancements in recombinant DNA technology have made it feasible to produce CKLFSF4 in sufficient quantities for detailed functional studies. By elucidating the biological roles and pathways associated with CKLFSF4, scientists aim to deepen our understanding of its relevance in human health and disease, paving the way for innovative diagnostic and treatment strategies.
