Analytical Data
-
Gene name
Ang4
- Application
-
Alternative Names
Ang4；ANG3；ANG4；Angiopoietin-4
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3TMQ6
-
Expression Region
25-144aa
-
AA Sequence
QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
-
Molecular Weight
29.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ang4 (Angiopoietin-4) is a member of the angiopoietin family that plays a crucial role in angiogenesis, vascular remodeling, and the regulation of inflammation. Investigations into Ang4 have gained significant attention due to its involvement in various physiological and pathological processes, including cancer metastasis, diabetic complications, and inflammatory diseases. Notably, Ang4 is expressed in endothelial cells and other tissues under certain conditions, highlighting its role in modulating blood vessel formation and maintenance. Research has revealed that Ang4 can bind to its receptor Tie2, influencing cell signaling pathways that affect vascular stability and permeability. Its unique properties, such as the ability to promote endothelial cell survival and migration, position Ang4 as a potential therapeutic target for conditions characterized by abnormal angiogenesis. Moreover, the study of Ang4's role in the tumor microenvironment has demonstrated its contribution to tumor vascularization and the facilitation of cancer cell dissemination. Additionally, emerging evidence suggests that Ang4 may have a role in metabolic regulation, further expanding its relevance in understanding complex disease mechanisms. Overall, the exploration of Ang4 and its functions offers promising insights into innovative therapeutic strategies aimed at modulating angiogenesis and addressing a range of diseases, making it a key focus in vascular biology and translational research.
