Analytical Data
-
Gene name
CLLU1
- Application
-
Alternative Names
CLLU1Chronic lymphocytic leukemia up-regulated protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5K131
-
Expression Region
1-121aa
-
AA Sequence
MFNKCSFHSSIYRPAADNSASSLCAIICFLNLVIECDLETNSEINKLIIYLFSQNNRIRFSKLLLKILFYISIFSYPELMCEQYVTFIKPGIHYGQVSKKHIIYSTFLSKNFKFQLLRVCW
-
Molecular Weight
40.26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLLU1, or Chronic Lymphocytic Leukemia Up-regulated Gene 1, is a protein that has gained interest in cancer research due to its association with chronic lymphocytic leukemia (CLL) and other malignancies. Studies have shown that CLLU1 is overexpressed in CLL cells compared to normal lymphocytes, suggesting its potential role in the disease's pathogenesis and progression. Researchers are focused on understanding the molecular mechanisms underlying CLLU1 function and its interactions within cellular signaling pathways. Given its cancer-specific expression, CLLU1 also presents a promising target for the development of novel therapeutics and diagnostic markers. Investigating CLLU1 could lead to advancements in personalized medicine strategies, offering insights into patient-specific tumor biology and treatment responses. By revealing its functional roles and regulatory networks, further studies on CLLU1 may contribute to better prognostic tools and innovative therapeutic approaches in managing CLL and other related neoplasms.











