Cat: PA1000-7353

Recombinant Human DAPK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DAPK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DAPK1;DAPK;Death-associated Protein kinase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P53355

  • Expression Region

    2-363aa

  • AA Sequence

    TVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKS SRRGVSREDIEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGEL FDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRN VPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMW SIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYFSNTSALAKDF IRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAA RKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHA INDDNVPGLQHL

  • Molecular Weight

    67 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DAPK1 (Death-Associated Protein Kinase 1) is a serine/threonine kinase that plays a crucial role in various cellular processes, including apoptosis, autophagy, and cellular response to stress. It is particularly significant in the regulation of tumor suppression and has been implicated in the pathogenesis of various cancers. Research has shown that DAPK1 is often downregulated or inactivated in malignant tumors, contributing to tumor progression and resistance to therapy. The study of DAPK1 recombinant proteins is essential for understanding its functional mechanisms and interactions with other cellular pathways. By producing DAPK1 as a recombinant protein, researchers can investigate its enzymatic activity, identify potential substrates, and explore its role in signaling pathways associated with cancer. Additionally, recombinant DAPK1 can be utilized as a tool for drug discovery, enabling the screening of small molecules that may activate or inhibit its activity. The therapeutic potential of targeting DAPK1 in cancer treatment has garnered increasing interest, making it a significant focus for ongoing research. Insights obtained from DAPK1 recombinant protein studies may lead to the development of novel therapeutic strategies aimed at enhancing cancer cell sensitivity to treatment while further elucidating its role in normal cellular functions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US