Analytical Data
-
Gene name
SLC25A30
- Application
-
Alternative Names
SLC25A30;KMCP1;UCP6;Kidney mitochondrial carrier Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5SVS4
-
Expression Region
1-291aa
-
AA Sequence
MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNTIQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKLDL
-
Molecular Weight
48.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A30, a member of the SLC25 family of mitochondrial solute carriers, is primarily responsible for the transport of aspartate and glutamate across the inner mitochondrial membrane, playing a crucial role in cellular metabolism and energy production. Its functionality is integral to the malate-aspartate shuttle, which is vital for the transfer of reducing equivalents into mitochondria, thereby influencing ATP synthesis and metabolic homeostasis. Research on SLC25A30 has garnered attention due to its potential implications in various physiological and pathological contexts, including metabolic disorders and neurodegenerative diseases. Recombinant SLC25A30 protein can be produced to study its transport mechanisms, substrate specificity, and interaction with other mitochondrial proteins. Understanding the structure-function relationship of this transporter can yield insights into its role in cellular metabolism and disease mechanisms. As a result, SLC25A30 serves as a significant target for further investigation, with the potential to unravel novel therapeutic strategies aimed at enhancing mitochondrial function and addressing related diseases.











