Analytical Data
-
Gene name
DLK2
- Application
-
Alternative Names
DLK2；EGFL9；Protein delta homolog 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UY11
-
Expression Region
1-306aa
-
AA Sequence
MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS
-
Molecular Weight
70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DLK2, also known as Delta-like protein 2, is a member of the Notch signaling pathway, which plays a crucial role in cell development, differentiation, and communication. This protein is particularly important in the regulation of neural and adipocyte differentiation. Given its involvement in various biological processes, DLK2 has attracted significant attention in recent years, particularly in the context of cancer research and metabolic disorders. Studies have indicated that DLK2 may influence tumor progression and the maintenance of stem cell properties, making it a potential target for therapeutic intervention. Additionally, the synthesis of recombinant DLK2 proteins has facilitated in-depth studies on the structure-function relationship of this protein, allowing researchers to explore its interactions with other cellular molecules. The production of these recombinant proteins through modern techniques like recombinant DNA technology also enables functional assays to assess the implications of DLK2 in different signaling pathways. As researchers continue to uncover the multifaceted roles of DLK2 within the cellular environment, understanding its mechanisms at a molecular level could pave the way for novel treatments for diseases influenced by aberrant Notch signaling.
