Analytical Data
-
Gene name
FOLR1
- Application
-
Alternative Names
FOLR1；FOLR；Folate receptor alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15328
-
Expression Region
25-233aa
-
AA Sequence
RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM
-
Molecular Weight
25.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FOLR1, or folate receptor 1, is a membrane-bound glycoprotein that plays a crucial role in cellular folate uptake, which is vital for DNA synthesis, repair, and methylation processes. Its expression is particularly upregulated in several types of cancer, making it a significant biomarker and therapeutic target. Research into FOLR1 has gained momentum due to its potential applications in targeted drug delivery and cancer immunotherapy. The overexpression of FOLR1 in tumor tissues, while being low in normal adult tissues, presents opportunities for developing FOLR1-targeted therapies that can specifically target cancer cells while sparing healthy cells. This specificity is essential for minimizing side effects commonly associated with traditional chemotherapeutics. Recent advancements in recombinant protein technology allow for the production of FOLR1 and its derivatives, paving the way for novel diagnostic tools, such as imaging agents and antibody-drug conjugates. Investigating the structure and function of FOLR1 not only aids in understanding its role in cancer biology but also enhances the development of innovative treatments. As researchers continue to explore the therapeutic potential of FOLR1, its role in promoting tumor progression and influencing the tumor microenvironment remains an active area of study, offering promise for improved cancer management strategies.
