Cat: PA1000-7542

Recombinant Human CAMK4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CAMK4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CAMK4;CAMK;CAMK-GR;CAMKIV;Calcium/calmodulin-dependent Protein kinase type IV

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16566

  • Expression Region

    1-473aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMLKVTVPSCSASSCSSVTASAAPGTA SLVPDYWIDGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQKPYALKV LKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGEL FDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPA PDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWS VGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDL VRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKL KAAVKAVVASSRLGSASSSHGSIQESHKASRDPSPIQDGNEDMKAIPEGE KIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIK VADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CAMK4 (Calcium/Calmodulin-dependent Protein Kinase IV) is a serine/threonine kinase that plays a crucial role in various cellular processes, including gene expression, neuronal signaling, and immune responses. Its activation is primarily dependent on calcium influx and subsequent binding of calmodulin, which allows CAMK4 to translocate to the nucleus and phosphorylate various substrates, including transcription factors such as CREB (cAMP response element-binding protein). Dysregulation of CAMK4 has been implicated in a range of pathological conditions, including neurological disorders, cardiovascular diseases, and cancer. Research into the recombinant expression of CAMK4 is vital for elucidating its functional mechanisms, as well as for the development of potential therapeutic strategies targeting its pathways. Generating recombinant CAMK4 not only facilitates structural and functional studies but also allows for the examination of its interactions with other proteins and the downstream effects of its activity. Advances in recombinant technology have made it possible to produce CAMK4 in heterologous systems, leading to greater yields and more straightforward purification processes. These studies contribute to a deeper understanding of CAMK4's role in health and disease, and highlight its potential as a biomarker or therapeutic target. Overall, the investigation of recombinant CAMK4 is significant for both basic research and clinical applications, offering insights that could pave the way for innovative treatments for diverse ailments associated with calcium signaling and kinase activity.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US