Analytical Data
-
Gene name
CRR9
- Application
-
Alternative Names
CLPTM1L; CRR9; Cleft lip and palate transmembrane protein 1-like protein; CLPTM1-like protein; Cisplatin resistance-related protein 9; CRR9p
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96KA5
-
Expression Region
1-538aa
-
AA Sequence
MWSGRSSFTSLVVGVFVVYVVHTCWVMYGIVYTRPCSGDANCIQPYLARRPKLQLSVYTTTRSHLGAENNIDLVLNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVSYDKVSLGRLRFWIHMQDAVYSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLVPAGVGAAIELWKVKKALKMTIFWRGLMPEFQFGTYSESERKTEEYDTQAMKYLSYLLYPLCVGGAVYSLLNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYEEKATRAPHTD
-
Molecular Weight
84.92 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRR9, or Cinnamoyl-CoA Reductase 9, is a key enzyme involved in the biosynthetic pathway of lignin, a crucial component of plant cell walls that provides structural integrity and resistance to pathogens. Understanding the function and regulation of CRR9 is important for various applications, including the improvement of biomass for biofuel production, enhancement of wood quality in forestry, and the development of plants with desirable traits for agriculture. Research into CRR9 has gained significant attention due to its potential roles in plant metabolism and its implications for sustainable resource management. Recent studies have explored its expression patterns, regulation by environmental factors, and interaction with other metabolic pathways. By investigating the recombinant forms of CRR9—produced through genetic engineering techniques—researchers aim to elucidate its biochemical properties and how it contributes to lignin synthesis. This understanding can pave the way for biotechnological applications that leverage CRR9 for generating high-value crops with enhanced growth and stress resistance, thereby addressing the challenges of food security and environmental sustainability in the context of a changing climate. Overall, the study of CRR9 not only sheds light on fundamental aspects of plant biology but also holds significant promise for advancing agricultural practices and sustainable biotech innovations.
