Analytical Data
-
Gene name
CTPS
- Application
-
Alternative Names
CTPS1; CTPS; CTP synthase 1; EC 6.3.4.2; CTP synthetase 1; UTP--ammonia ligase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17812
-
Expression Region
1-591aa
-
AA Sequence
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
-
Molecular Weight
68.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTPS (Cytidine Triphosphate Synthase) is a pivotal enzyme in the de novo synthesis pathway of pyrimidine nucleotides, essential for DNA and RNA synthesis. It catalyzes the conversion of UTP to CTP using ammonia and ATP as substrates. Given its central role in nucleotide metabolism, CTPS has garnered interest as a target for therapeutic interventions in various diseases, including cancer, where pyrimidine metabolism is often dysregulated. Research has revealed that CTPS activity is closely linked to cell proliferation and survival, making it a critical player in rapidly dividing cells. The enzyme is known to exist in multiple isoforms, which may have distinct regulatory mechanisms and tissue-specific functions. Understanding the structural and functional properties of CTPS and its isoforms is crucial for developing targeted inhibitors that could serve as potential anti-cancer drugs. Recent advancements in recombinant protein technology have facilitated the study of CTPS in vitro, allowing for the exploration of its catalytic mechanisms, regulation, and interactions with other cellular components. This research not only contributes to our understanding of nucleotide metabolism but also paves the way for innovative therapeutic strategies to combat diseases associated with dysregulated cell growth and proliferation.
