Analytical Data
-
Gene name
CTSL3
- Application
-
Alternative Names
CTSL3P; CTSL3Putative inactive cathepsin L-like protein CTSL3P; Cathepsin L3 pseudogene; HCTSL-s
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5NE16
-
Expression Region
1-218aa
-
AA Sequence
MKMIEQHNQEYREGKHSFTMAMNAFGEMTSEEFRQVVNGFQNQKHRKGKVLQEPLLHDIRKSVDWREKGYVTPVKDQCSWGSVRTDVRKTEKLVSLSVQTWWTALGFKAMLAAFLENHYFASSMLPTMEAWTLRNPFHMKKSSGDWKVQGHRGASGESLLASGESQQSPEVAQYSGKHQVQCHLIEEALQMLSGGDEDHDEDKWPHDMRNHLAGEAQV
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTSL3 (cathepsin L3) is a cysteine protease originally identified for its involvement in protein degradation and processing within lysosomes. This enzyme plays a significant role in various physiological and pathological processes, including antigen presentation, bone remodeling, and tumor progression. Research into CTSL3 has gained attention due to its potential implications in diseases such as cancer and neurodegenerative disorders, where altered protease activity can lead to aberrant protein accumulation and cell signaling. The recombinant expression of CTSL3 allows for detailed biochemical characterization and the exploration of its functional roles in cellular contexts. Studying the recombinant protein facilitates the investigation of substrate specificity, inhibitor development, and the understanding of its interactions with different cellular components. Recent advances in biotechnology have enabled researchers to produce CTSL3 in heterologous systems, leading to a more profound understanding of its structure-function relationships and the development of therapeutic strategies targeting CTSL3-related pathways. The ongoing research aims to unravel the mechanisms through which CTSL3 contributes to disease processes, potentially identifying novel biomarkers or therapeutic targets for clinical intervention.
