Cat: PA1000-7686

Recombinant E.coli ASC1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ASC1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ASC1;ASH1;BHLHA46;HASH1;Achaete-scute homolog 1

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P38011

  • Expression Region

    2-319aa

  • AA Sequence

    ASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN

  • Molecular Weight

    41.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ASC1 (ASC1 protein, also known as Assembled Complex 1) is a key regulatory protein involved in multiple cellular processes, including metabolism, stress response, and possibly tumorigenesis. It functions primarily as a transcriptional coactivator, enhancing the activity of various nuclear receptors and transcription factors. Research into ASC1 has gained momentum due to its emerging roles in modulating gene expression, influencing cell proliferation, and mediating responses to environmental stimuli. Studies have shown that dysregulation of ASC1 is associated with several diseases, particularly cancers, where its expression levels often correlate with tumor progression and patient prognosis. Given its significant involvement in cellular pathways, ASC1 represents a potential therapeutic target, with the development of ASC1 recombinant proteins facilitating functional assays to investigate its mechanisms of action. The generation of recombinant ASC1 allows researchers to explore its interactions with other proteins, characterize its structural properties, and assess its role in specific biological contexts. By leveraging advanced techniques in molecular biology and biochemistry, ongoing investigations aim to delineate the specific contributions of ASC1 to health and disease, paving the way for novel interventions that may disrupt its pathological activities in tumors or other diseases. Thus, the study of ASC1 not only deepens our understanding of fundamental biological processes but also holds promise for advancing therapeutic strategies against various health conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US