Analytical Data
-
Gene name
SLC35A1
- Application
-
Alternative Names
CMP-SA-Tr; CMP-Sia-Tr; CMP-sialic acid transporter; S35A1_HUMAN; Slc35a1; Solute carrier family 35 member A1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78382
-
Expression Region
1-337 aa
-
AA Sequence
MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV
-
Molecular Weight
63.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC35A1, a member of the solute carrier family, encodes a nucleotide sugar transporter primarily involved in the transportation of UDP-glucuronic acid into the Golgi apparatus. This transporter plays a critical role in glycosylation processes, which are vital for the proper functioning of various proteins and lipids. Mutations in the SLC35A1 gene are linked to a rare autosomal recessive disorder known as Congenital Disorder of Glycosylation (CDG), specifically CDG-Iq. Patients with this disorder often exhibit a wide range of clinical symptoms, including developmental delays, neurological impairments, and immune dysfunction, highlighting the importance of SLC35A1 in maintaining cellular homeostasis and health. Research into recombinant SLC35A1 protein has focused on understanding its structure, function, and the mechanisms by which mutations lead to disease. Recombinant expression systems allow for the production of the protein in sufficient quantities for detailed biochemical studies, including substrate specificity and transport kinetics. These studies aim to elucidate the relationship between SLC35A1 dysfunction and disease, potentially paving the way for therapeutic interventions. Furthermore, understanding the transport mechanisms of SLC35A1 could provide insights into the broader implications of nucleotide sugar transport in glycosylation disorders, thereby advancing knowledge in both basic science and clinical approaches to treat related conditions.
