Analytical Data
-
Gene name
SLC35E2
- Application
-
Alternative Names
SLC35E2A; SLC35E2; Solute carrier family 35 member E2A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0CK97
-
Expression Region
1-266 aa
-
AA Sequence
MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITETTVIESDLGVWSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGCVKTLVPCCLYQHKARLSYPPNFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGRPSDREEREELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLPAS
-
Molecular Weight
55.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC35E2 is a member of the solute carrier (SLC) family of transporters, which play crucial roles in the transport of various substrates across cellular membranes. The SLC35E2 gene is implicated in nucleoside and nucleotide transport, which are vital for numerous cellular processes, including metabolism and signaling. Recent studies have highlighted the significance of SLC35E2 in various physiological and pathological conditions, including its potential involvement in cancer progression and resistance to chemotherapy. The functional characterization of the SLC35E2 recombinant protein has attracted attention, as understanding its transport mechanisms can reveal insights into its role in cellular homeostasis and disease. Additionally, the study of SLC35E2 can contribute to the development of targeted therapies, particularly in cancer treatment, where altering nucleoside metabolism may enhance the efficacy of existing drugs. Research on this transporter could also provide novel strategies for addressing drug resistance, thus improving patient outcomes. Overall, the investigation of SLC35E2 recombinant protein serves as a promising area of study with the potential to enhance our understanding of cell biology and therapeutic interventions.
