Cat: PA1000-7695

Recombinant Human AD Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AD

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AD;CINAP;Adenylate kinase isoenzyme 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P23793

  • Expression Region

    2-410aa

  • AA Sequence

    SVFDSKFKGIHVYSEIGELESVLVHEPGREIDYITPARLDELLFSAILES HDARKEHKQFVAELKANDINVVELIDLVAETYDLASQEAKDKLIEEFLED SEPVLSEEHKVVVRNFLKAKKTSRELVEIMMAGITKTDLGIEADHELIVD PMPNLYFTRDPFASVGNGVTIHYMRYKVRQRETLFSRFVFSNHPKLINTP WYYDPSLKLSIEGGDVFIYNNDTLVVGVSERTDLQTVTLLAKNIVANKEC EFKRIVAINVPKWTNLMHLDTWLTMLDKDKFLYSPIANDVFKFWDYDLVN GGAEPQPVENGLPLEGLLQSIINKKPVLIPIAGEGASQMEIERETHFDGT NYLAIRPGVVIGYSRNEKTNAALEAAGIKVLPFHGNQLSLGMGNARCMSM PLSRKDVKW

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AD (Alzheimer's Disease) is a progressive neurodegenerative disorder characterized by cognitive decline, memory loss, and behavioral changes. It is primarily associated with the accumulation of amyloid-beta (Aβ) plaques and tau protein tangles in the brain, leading to synaptic dysfunction and neuronal death. The complexity of AD pathology has driven researchers to explore various therapeutic strategies, including the development of recombinant proteins that target specific aspects of the disease. Recombinant proteins, engineered through genetic technology, can be designed to enhance the clearance of amyloid plaques, inhibit tau aggregation, or modulate neuroinflammation, thereby providing potential avenues for treatment. Additionally, these proteins can serve as valuable tools for understanding the underlying mechanisms of the disease and for screening drug candidates. Advances in molecular biology and biotechnology have significantly improved the production and characterization of these proteins, making it feasible to develop more effective interventions. As research progresses, the focus continues to be on optimizing the efficacy and safety of AD recombinant proteins, with the ultimate goal of modifying the disease's trajectory and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US