Analytical Data
-
Gene name
CXXC6
- Application
-
Alternative Names
bA119F7.1; CXXC 6; CXXC finger 6; CXXC type zinc finger protein 6; CXXC zinc finger 6; CXXC-type zinc finger protein 6; CXXC6; KIAA1676; LCX; Leukemia associated protein with a CXXC domain
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NFU7
-
Expression Region
2038-2136aa
-
AA Sequence
RNHPTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNELNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXXC6 is a member of the CXXC family of proteins, which are characterized by the presence of the CXXC motif, suggesting a role in zinc binding and redox regulation. Research into CXXC6 has gained significance due to its potential involvement in various biological processes, including cellular signaling, gene expression regulation, and stress responses. Notably, studies have indicated that CXXC6 may play a role in the regulation of transcription factors and is implicated in pathways associated with cancer progression and metastasis. Additionally, CXXC6 has been shown to interact with key cellular partners, influencing processes such as cell proliferation and differentiation. Investigating the recombinant expression of CXXC6 provides valuable insights into its structural and functional properties, facilitating the exploration of its role in human health and disease. Understanding the dynamics of CXXC6 at a molecular level could pave the way for therapeutic interventions targeting related pathways, making this research area a promising frontier in molecular biology and biotechnology.
