Analytical Data
-
Gene name
XPC
- Application
-
Alternative Names
XPC；XPCC；DNA repair Protein complementing XP-C cells
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01831
-
Expression Region
496-734aa
-
AA Sequence
SLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCV DCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRK CRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHP LYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKAR VVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFG
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
XPC (Xeroderma Pigmentosum Complementation Group C) is a crucial protein involved in the nucleotide excision repair (NER) pathway, which is responsible for recognizing and repairing bulky DNA adducts, such as those induced by UV radiation and chemical mutagens. Mutations in the XPC gene lead to xeroderma pigmentosum (XP), a genetic disorder characterized by extreme sensitivity to ultraviolet (UV) light, resulting in a high predisposition to skin cancers and other skin lesions. The importance of XPC in the cellular response to DNA damage has prompted extensive research into the structure and function of the XPC protein. Understanding its mechanism of action is essential for developing potential therapeutic strategies for XP and related disorders. Studies have shown that XPC acts as a damage sensor, detecting DNA lesions and initiating the repair process by recruiting other essential proteins involved in NER. Furthermore, the study of XPC’s interactions with DNA and its role in the recognition of damaged sites provides insight into the fundamental processes of DNA repair and aging. This research not only sheds light on the etiology of XP but also has broader implications for understanding cancer biology and improving strategies for cancer prevention and treatment.
