Analytical Data
-
Gene name
DCAF4
- Application
-
Alternative Names
DCAF4;WDR21;WDR21A;DDB1- and CUL4-associated factor 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WV16
-
Expression Region
1-495aa
-
AA Sequence
MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLAHELRLSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYGIINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDSHILLCLMGLAETPGCATLLPASLFVNSHPGIDRPGMLCSFRIPGAWSCAWSLNIQANNCFSTGLSRRVLLTNVVTGHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKATRLFHDSAVTSVRILQDEQYLMASDMAGKIKLWDLRTTKCVRQYEGHVNEYAYLPLHVHEEEGILVAVGQDCYTRIWSLHDARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS
-
Molecular Weight
71.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCAF4 (DDB1 and CUL4 associated factor 4) is a protein that plays a critical role in the cellular response to various stresses, including DNA damage and protein misfolding. It is part of the DDB1-CUL4-RING ubiquitin ligase complex, which is essential for targeting substrates for ubiquitination, a process that regulates protein stability and function. Research has shown that DCAF4 is involved in the modulation of several key cellular pathways, such as cell cycle progression and apoptosis, highlighting its importance in maintaining cellular homeostasis. The dysfunction of DCAF4 has been associated with various diseases, including cancer, where altered ubiquitination processes can contribute to tumorigenesis. Furthermore, understanding the structural and functional characteristics of DCAF4 and its interactions with other cellular components is crucial for uncovering its mechanisms in cellular regulation. As a result, studies involving the recombinant expression of DCAF4 have gained momentum, aiming to elucidate its role in protein degradation pathways and explore its potential as a therapeutic target in diseases characterized by aberrant ubiquitination. Insights gained from these studies could pave the way for novel strategies in disease treatment, ultimately contributing to the fields of molecular biology and therapeutic development.











