Analytical Data
-
Gene name
DAZ4
- Application
-
Alternative Names
DAZ4Deleted in azoospermia protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86SG3
-
Expression Region
1-390aa
-
AA Sequence
MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD
-
Molecular Weight
70.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DAZ4 (Deleted in Azoospermia 4) is a member of the DAZ gene family, which plays a critical role in spermatogenesis and male fertility. The DAZ family is known for its involvement in the regulation of germ cell development and maturation, with alterations in these genes often leading to reproductive disorders, including azoospermia and oligospermia. Research has highlighted that DAZ4, specifically, is essential for the proper functioning of germ cells, influencing processes such as RNA binding, post-transcriptional regulation, and translational control. Scientists have noted that DAZ4 interacts with various proteins and RNA molecules, thereby impacting gene expression during spermatogenesis. Furthermore, mutations or deletions in DAZ gene regions can compromise male fertility, making DAZ4 a focal point for studies aimed at understanding infertility mechanisms. Emerging evidence suggests that DAZ4's dysfunction may contribute to the pathogenesis of certain male infertility conditions, stimulating efforts to explore potential therapeutic approaches targeting this gene. Consequently, ongoing research into DAZ4 not only seeks to elucidate its biological functions and mechanisms but also aims to develop strategies for diagnosing and treating male infertility linked to DAZ gene abnormalities. This growing body of work underscores the importance of DAZ4 in reproductive biology and its potential implications for understanding and addressing male infertility.
