Cat: PA2000-7054

Recombinant Human DDX55 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DDX55

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ATP dependent RNA helicase DDX55; ATP-dependent RNA helicase DDX55; DDX 55; ddx55; DDX55_HUMAN; DEAD box protein 55; FLJ16577; KIAA1595; MGC33209

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NHQ9

  • Expression Region

    1-207aa

  • AA Sequence

    MKPQRNTADLLPKLKSMALADRAVFEKGMKAFVSYVQAYAKHECNLIFRLKDLDFASLARGFALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIKNKAWSKQKAKKEKKKKMNEKRKREEGSDIEDEDMEELLNDTRLLKKLKKGKITEEEFEKGLLTTGKRTIKTVDLGISDLEDDC

  • Molecular Weight

    50.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DDX55, a member of the DEAD-box RNA helicase family, plays a pivotal role in various cellular processes, including RNA metabolism, gene expression regulation, and ribosome biogenesis. Its dysfunction has been implicated in several diseases, particularly in the context of cancer, where altered RNA processing can lead to malignant transformation. Recent studies have highlighted the significance of DDX55 in facilitating the unwinding of RNA structures, thereby influencing mRNA stability and translation efficiency. Given its essential functions, there is a growing interest in investigating DDX55 as a potential therapeutic target. Recombinant DDX55 protein production is crucial for understanding its biochemical properties, interactions with RNA, and effects in disease models. By generating and characterizing this recombinant protein, researchers aim to elucidate the molecular mechanisms underlying DDX55 activity and its role in pathological conditions, ultimately contributing to the development of novel therapeutic strategies. This research holds promise not only for advancing our understanding of RNA helicases but also for the potential exploitation of DDX55 in therapeutic applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US