Analytical Data
-
Gene name
DDX55
- Application
-
Alternative Names
ATP dependent RNA helicase DDX55; ATP-dependent RNA helicase DDX55; DDX 55; ddx55; DDX55_HUMAN; DEAD box protein 55; FLJ16577; KIAA1595; MGC33209
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHQ9
-
Expression Region
1-207aa
-
AA Sequence
MKPQRNTADLLPKLKSMALADRAVFEKGMKAFVSYVQAYAKHECNLIFRLKDLDFASLARGFALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIKNKAWSKQKAKKEKKKKMNEKRKREEGSDIEDEDMEELLNDTRLLKKLKKGKITEEEFEKGLLTTGKRTIKTVDLGISDLEDDC
-
Molecular Weight
50.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX55, a member of the DEAD-box RNA helicase family, plays a pivotal role in various cellular processes, including RNA metabolism, gene expression regulation, and ribosome biogenesis. Its dysfunction has been implicated in several diseases, particularly in the context of cancer, where altered RNA processing can lead to malignant transformation. Recent studies have highlighted the significance of DDX55 in facilitating the unwinding of RNA structures, thereby influencing mRNA stability and translation efficiency. Given its essential functions, there is a growing interest in investigating DDX55 as a potential therapeutic target. Recombinant DDX55 protein production is crucial for understanding its biochemical properties, interactions with RNA, and effects in disease models. By generating and characterizing this recombinant protein, researchers aim to elucidate the molecular mechanisms underlying DDX55 activity and its role in pathological conditions, ultimately contributing to the development of novel therapeutic strategies. This research holds promise not only for advancing our understanding of RNA helicases but also for the potential exploitation of DDX55 in therapeutic applications.
