Analytical Data
-
Gene name
DHFRL1
- Application
-
Alternative Names
DHFR2; DHFRL1; DHFRP4Dihydrofolate reductase 2; mitochondrial; Dihydrofolate reductase; mitochondrial; EC 1.5.1.3; Dihydrofolate reductase-like protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86XF0
-
Expression Region
1-187aa
-
AA Sequence
MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DHFRL1, or Dihydrofolate Reductase-Like 1, is a protein that plays a crucial role in folate metabolism and cellular response to oxidative stress. It was initially identified due to its homology to the well-studied dihydrofolate reductase (DHFR), an enzyme involved in the folate pathway that is essential for DNA synthesis and repair. Research has indicated that DHFRL1 may possess distinct functions, not only participating in the folate cycle but also serving as a protective factor against cellular damage caused by reactive oxygen species. Its expression has been linked to various physiological processes, including cell proliferation and apoptosis. Importantly, altered levels of DHFRL1 have been associated with several diseases, including cancer and neurodegenerative disorders, making it a potential biomarker or therapeutic target. However, much remains to be explored concerning its precise mechanisms of action and regulatory pathways. The study of recombinant DHFRL1 protein is therefore imperative, as it allows for the detailed investigation of its enzymatic properties, interactions with other biomolecules, and potential roles in disease contexts. Understanding DHFRL1's function could pave the way for novel therapeutic strategies aimed at enhancing cellular resilience and mitigating pathophysiological conditions linked to folate metabolism dysregulation. In summary, the research on DHFRL1 recombinant protein is poised to significantly contribute to our understanding of folate-related processes and their implications for human health and disease.
