Cat: PA2000-7098

Recombinant Human DHRS4L2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DHRS4L2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Short chain dehydrogenase/reductase family 25C member 3;Protein SDR25C3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6PKH6

  • Expression Region

    20-232aa

  • AA Sequence

    ASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA

  • Molecular Weight

    23.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DHRS4L2 (Dehydrogenase/Reductase 4-like 2) is a member of the short-chain dehydrogenase/reductase (SDR) family, which plays a crucial role in various biological processes, including lipid metabolism, steroidogenesis, and cellular signaling. This enzyme is primarily involved in the oxidative and reductive metabolism of aldehydes and ketones, contributing to the regulation of metabolic pathways. Research targeting DHRS4L2 has gained attention due to its potential implications in human health and disease, particularly in metabolic disorders and cancer. The recombinant expression of DHRS4L2 allows for a deeper understanding of its enzymatic properties and substrate specificity, facilitating the exploration of its physiological functions. In addition, the production of DHRS4L2 as a recombinant protein is vital for the development of therapeutic approaches that could modulate its activity. Studies have indicated that DHRS4L2 may interact with various signaling pathways, suggesting its involvement in cellular responses to stress and its potential role in influencing cell survival and proliferation. Understanding the structure-function relationship of DHRS4L2 through recombinant protein studies may also pave the way for the identification of novel drug targets. Consequently, the investigation of DHRS4L2 as a recombinant protein is imperative for advancing our knowledge of metabolic regulation, the molecular mechanisms underlying diseases, and the development of targeted therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US