Analytical Data
-
Gene name
DHRS4L2
- Application
-
Alternative Names
Short chain dehydrogenase/reductase family 25C member 3;Protein SDR25C3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PKH6
-
Expression Region
20-232aa
-
AA Sequence
ASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA
-
Molecular Weight
23.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DHRS4L2 (Dehydrogenase/Reductase 4-like 2) is a member of the short-chain dehydrogenase/reductase (SDR) family, which plays a crucial role in various biological processes, including lipid metabolism, steroidogenesis, and cellular signaling. This enzyme is primarily involved in the oxidative and reductive metabolism of aldehydes and ketones, contributing to the regulation of metabolic pathways. Research targeting DHRS4L2 has gained attention due to its potential implications in human health and disease, particularly in metabolic disorders and cancer. The recombinant expression of DHRS4L2 allows for a deeper understanding of its enzymatic properties and substrate specificity, facilitating the exploration of its physiological functions. In addition, the production of DHRS4L2 as a recombinant protein is vital for the development of therapeutic approaches that could modulate its activity. Studies have indicated that DHRS4L2 may interact with various signaling pathways, suggesting its involvement in cellular responses to stress and its potential role in influencing cell survival and proliferation. Understanding the structure-function relationship of DHRS4L2 through recombinant protein studies may also pave the way for the identification of novel drug targets. Consequently, the investigation of DHRS4L2 as a recombinant protein is imperative for advancing our knowledge of metabolic regulation, the molecular mechanisms underlying diseases, and the development of targeted therapeutic strategies.
