Analytical Data
-
Gene name
NUMB
- Application
-
Alternative Names
NUMB；C14orf41；Protein numb homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5D0E5
-
Expression Region
1-135aa
-
AA Sequence
MPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYE ASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPF EAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NUMB is a multifunctional protein that plays critical roles in cellular processes such as cell fate determination, differentiation, and proliferation. It is particularly known for its involvement in the regulation of signaling pathways, including the Notch pathway, which is essential for various developmental processes. NUMB exists in several isoforms, arising from alternative splicing, each with distinct functions in different cellular contexts. Research has shown that NUMB can act as an antagonist to the Notch signaling pathway, influencing the balance between self-renewal and differentiation in stem cells. Additionally, NUMB has been implicated in neurogenesis, cancer biology, and the maintenance of tissue homeostasis. Dysregulation of NUMB expression or function has been associated with several diseases, including cancer, where it can influence tumor progression and metastasis. As a result, understanding the mechanisms regulating NUMB expression and its interactions with other cellular components is of paramount importance for developing targeted therapies. Recent studies have focused on the structural characterization of NUMB, particularly its domains responsible for binding to various partners and mediating its cellular functions. By exploring the functional implications of NUMB isoforms and their regulatory mechanisms, researchers aim to unravel its potential as a therapeutic target and biomarker in diseases involving aberrant cell signaling and fate decisions.
