Analytical Data
-
Gene name
SSB1
- Application
-
Alternative Names
SPRY domain-containing SOCS box protein 1. SSB-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96BD6
-
Expression Region
1-273 aa
-
AA Sequence
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDDKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ
-
Molecular Weight
55.77 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SSB1, or Single Strand Binding Protein 1, is a crucial protein involved in the maintenance of genomic stability and the regulation of DNA replication and repair processes. It plays a significant role in binding to single-stranded DNA (ssDNA) during various cellular processes, including DNA replication, repair, and recombination. The research on SSB1 has gained prominence due to its implications in the understanding of cancer biology and genetic disorders. Aberrant expression or mutations in SSB1 can lead to compromised DNA repair mechanisms, resulting in genomic instability and contributing to oncogenesis. Additionally, SSB1 is part of an intricate network of protein interactions that regulate DNA metabolism, making it a focal point for studies aimed at elucidating the molecular mechanisms of DNA-related diseases. Investigating SSB1's structure and function, as well as its interactions with other proteins, can provide insights into potential therapeutic targets for cancer treatment and improved strategies for gene therapy. The development of SSB1 recombinant proteins has enabled researchers to explore its biochemical properties, facilitating a deeper understanding of its role within the cell and its potential as a biomarker for various diseases. Overall, ongoing research on SSB1 is essential for advancing molecular biology and developing innovative therapeutic approaches.
