Cat: PA1000-7936

Recombinant Human SKP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SKP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SKP2;FBXL1;S-phase kinase-associated Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13309

  • Expression Region

    1-424aa

  • AA Sequence

    MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSEN IPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSL PDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPD VTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHG ILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQT LLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIP ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPT IGNKKNQEIWGIKCRLTLQKPSCL

  • Molecular Weight

    73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SKP2 (S-phase kinase-associated protein 2) is an E3 ubiquitin ligase known for its critical role in regulating the cell cycle and promoting oncogenic processes. It targets proteins such as p27Kip1 for ubiquitination, leading to their degradation and thereby facilitating cell cycle progression from the G1 to S phase. Overexpression of SKP2 has been implicated in various cancers, making it a potential biomarker for tumor progression and a target for therapeutic intervention. The study of recombinant SKP2 proteins has gained momentum as researchers seek to elucidate its precise mechanism of action and interactions with substrate proteins. Additionally, the production of SKP2 in a recombinant form allows for the investigation of its structural and functional properties in a controlled setting, providing insights that are essential for understanding its role in tumorigenesis. These studies can pave the way for the development of innovative cancer treatments aimed at modulating SKP2 activity, potentially inhibiting its function in cancer cells and restoring normal regulatory pathways in the cell cycle. Thus, the investigation of SKP2 recombinant proteins not only enhances our fundamental understanding of cell cycle regulation but also opens new avenues for cancer therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US