Analytical Data
-
Gene name
EYA3
- Application
-
Alternative Names
AI844637; DKFZp686C132; EYA3; EYA3_HUMAN; Eyes absent 3; Eyes absent 3 homolog (Drosophila) ; Eyes absent homolog 3; OTTMUSP00000010370; RP11-460I13.4; RP23-442A20.1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99504
-
Expression Region
1-536aa
-
AA Sequence
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQMYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYRKVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRDEEIAAKQQLYFLDMEALGCQLEPTALILFIQLSGNLSNYNKL
-
Molecular Weight
59 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EYA3, a member of the EYA family of transcriptional co-activators, plays a crucial role in various biological processes such as epithelial development, tissue regeneration, and cellular differentiation. This protein is characterized by its unique combination of a phosphatase domain and an Eyeless homology domain, which allow it to influence gene expression through protein-protein interactions and modulation of signaling pathways. Research into EYA3 has gained significant momentum due to its emerging association with several pathophysiological conditions, including cancers, where it has been linked to tumorigenesis and cancer progression. In addition, studies have indicated that EYA3 plays a pivotal role in the development of certain tissues, such as the eye and ear, as well as its involvement in the regulation of stem cell pluripotency. The unique structural and functional properties of EYA3 make it a promising target for therapeutic interventions. By understanding its biochemical pathways and mechanisms of action, researchers aim to develop novel strategies for disease treatment, particularly in oncology and regenerative medicine. The ongoing characterization of EYA3 through recombinant protein studies aims to elucidate its functional roles and molecular interactions, providing insights into its regulatory functions and potential as a biomarker for disease.
