Analytical Data
-
Gene name
DRD2
- Application
-
Alternative Names
DRD2;D(2) dopamine receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14416
-
Expression Region
214-373aa
-
AA Sequence
IVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQ
-
Molecular Weight
25.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Dopamine receptor D2 (DRD2) is a G-protein coupled receptor that plays a crucial role in the central nervous system, particularly in the regulation of dopamine signaling, which is involved in various physiological functions and pathological conditions. Abnormalities in DRD2 signaling are associated with several psychiatric disorders, including schizophrenia, bipolar disorder, and addiction. The study of DRD2 and its recombinant protein has garnered significant attention due to its implications in therapeutic strategies. Recombinant DRD2 proteins serve as valuable tools for understanding the structural, functional, and pharmacological properties of the receptor. They enable researchers to investigate the receptor's interactions with different ligands, identify potential drug targets, and explore the mechanisms underlying receptor activation and downstream signaling pathways. Additionally, understanding the dynamics of DRD2 can facilitate the development of new medications aimed at modulating its activity, offering hope for more effective treatments of dopamine-related disorders. The advent of advanced techniques in molecular biology and structural biology has further accelerated research in this area, allowing for the detailed characterization of DRD2 and its role in health and disease.











