Analytical Data
-
Gene name
ZNF621
- Application
-
Alternative Names
ZNF621; Zinc finger Protein 621
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZSS3
-
Expression Region
1-439 aa
-
AA Sequence
MLQTTWPQESVTFEDVAVYFTQNQWASLDPAQRALYGEVMLENYANVASLVAFPFPKPALISHLERGEAPWGPDPWDTEILRGISQGGESWIKNEGLVIKQEASEETELHRMPVGGLLRNVSQHFDFKRKALKQTFNLNPNLILRGGMKFYECKECGKIFRYNSKLIRHQMSHTGEKPFKCKECGKAFKSSYDCIVHEKNHIGEGPYECKECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRSAAYLQHQRLHTGEKLYKCKECWKAFGCRSLFIVHQRIHTGEKPYQCKECGKAFTQKIASIQHQRVHTGEKPYECKVCGKAFKWYGSFVQHQKLHPVEKKPVKVLGPSLVSPQCSSPAIPPVLLQGSCSASAVAVPSLTFPHAVLIPTSGNFFMLLPTSGIPSSSAQIVRVFQGLTPTVKPSPVILTPSSHSS
-
Molecular Weight
75.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF621, a member of the zinc finger protein family, has garnered significant research interest due to its potential roles in gene regulation and cellular processes. This protein is characterized by its unique zinc finger motifs, which facilitate DNA binding and the regulation of transcription. Initially identified through genomic studies, ZNF621 has been implicated in various biological functions, including embryonic development, differentiation, and responses to environmental cues. Recent investigations have suggested that ZNF621 may play a pivotal role in modulating pathways associated with neurodevelopmental disorders and cancers, making it a target of interest for therapeutic interventions. The functional characterization of ZNF621 and the development of recombinant versions of the protein have become vital for understanding its mechanisms of action. Researchers have focused on producing ZNF621 as a recombinantly expressed protein in suitable expression systems, allowing for further analysis of its structural properties and interaction with other cellular components. Understanding the biochemical properties and regulatory networks involving ZNF621 can provide insights into its potential as a biomarker and its contribution to disease pathology. This growing body of research underscores the importance of ZNF621 in molecular biology and its potential clinical significance, paving the way for future studies aimed at elucidating its role in health and disease.











