Analytical Data
-
Gene name
TSPO
- Application
-
Alternative Names
TSPO；BZRP；MBR；Translocator Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30536
-
Expression Region
1-169aa
-
AA Sequence
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Translocator protein (TSPO), previously known as the peripheral-type benzodiazepine receptor, has gained significant interest in the field of biomedical research due to its pivotal role in various physiological and pathological processes. TSPO is predominantly located in the outer mitochondrial membrane and is involved in the regulation of cholesterol transport, steroidogenesis, and apoptosis. Its expression is upregulated in response to cellular stress, inflammation, and neurodegeneration, making it a potential biomarker for various diseases, including cancer, neurodegenerative disorders, and psychiatric conditions. The development of TSPO as a target for therapeutic interventions has further propelled research into its structure and function. Recombinant TSPO proteins are essential for studying the molecular mechanisms, interactions, and signaling pathways associated with this protein. Additionally, the creation of TSPO knockout and transgenic animal models has provided valuable insights into its physiological roles and the implications of TSPO dysregulation. As TSPO is implicated in the manifestation of a range of diseases, understanding its biology through recombinant protein studies offers the potential for novel diagnostic and therapeutic strategies, including TSPO ligands that could modulate its activity or serve as imaging agents in disease contexts. The ongoing exploration of TSPO's role in health and disease underscores its significance as a target for future biomedical research and clinical applications.
